Pfam domain
Pfam family: YTH (PF04146.14)
Uniprot AC: C5E1V0
RecName: ZYRO0G01672p
Begin-End: 178-314
Organism: Zygosaccharomyces rouxii
Interaction Mode:   

Sequence:
SRFFVIKSSSLEHVKKSFYNGIWSSTFYGNKRLSEAYESLPQGAKIYLLFSVNASGRFCG
VAEMSSNLREDLDTSIWGDNSRYRHAFKVRWIVVRDVHNRSLKQFLIPANDMKPVTNSRD
TQEIPATISKSILKLFK
Structures of the domain C5E1V0 178-314
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4u8t X-ray 2.7 A 178-314 None
4u8t X-ray 2.7 B 178-314 None
4u8t X-ray 2.7 C 178-314 None
4u8t X-ray 2.7 D 178-314 None
4u8t X-ray 2.7 E 178-314 None
4u8t X-ray 2.7 F 178-314 None


© NPIDB team 2003 - 2019

text