Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: C7SQG1
RecName: Ribosomal protein 3/homing endonuclease-like fusion protein
Begin-End: 595-697
Organism: Grosmannia penicillata
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFTSGEGCFFVSLIKSKSKLGVQVQLVFSITQHARDRALMDNLVTYLGCGYIKEKKKS
EFSWLEFVVTKFSDIKDKIIPVFQVNNIIGVKLEDFEDWCKVA
Structures of the domain C7SQG1 595-697
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yhx X-ray 2.15 A 176-277  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text