Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.21)
Uniprot AC: C7SWF3
RecName: Ribosomal protein 3/homing endonuclease-like fusion protein
Begin-End: 419-516
Organism: Leptographium truncatum
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
ITGFADAESSFMLTVSKDSKRNTGWSVRPRFRIGLHNKDVTILKSIREYLGAGIITSDID
ARIRFESLKELEVVINHFDKYPLITQKRADYLLFKKAF
Structures of the domain C7SWF3 419-516
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bcf X-ray 2.92 D 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcf X-ray 2.92 A 22-119  S-Bb S-Mj L-Bb L-Mj 
6bcf X-ray 2.92 G 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcf X-ray 2.92 J 22-119  H-Bb L-Bb L-Mj 
3r7p X-ray 2.7 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bce X-ray 1.75 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcg X-ray 2.9 D 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcg X-ray 2.9 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcg X-ray 2.9 G 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcg X-ray 2.9 J 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bci X-ray 2.28 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcn X-ray 2.5 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcn X-ray 2.5 C 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcn X-ray 2.5 G 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bcn X-ray 2.5 J 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bct X-ray 2.73 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bch X-ray 3 L 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bch X-ray 3 H 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bch X-ray 3 D 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 
6bch X-ray 3 A 22-119  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text