Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: C7SWF3
RecName: Ribosomal protein 3/homing endonuclease-like fusion protein
Begin-End: 574-682
Organism: Leptographium truncatum
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
VAGFTAGEGSFYIRIAKNSTLKTGYQVQSVFQITQDTRDIELMKNLISYLNCGNIRIRKY
KGSEGIHDTCVDLVVTNLNDIKEKIIPFFNKNHIIGVKLQDYRDWCKVV
Structures of the domain C7SWF3 574-682
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3r7p X-ray 2.7 A 178-285  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text