Pfam domain
Pfam family: CBFD_NFYB_HMF (PF00808.22)
Uniprot AC: C8V0B5
RecName: Transcriptional activator
Begin-End: 85-149
Organism: Emericella nidulans
Interaction Mode:  H-Bb S-Bb 

Sequence:
HQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSD
IAAAL
Structures of the domain C8V0B5 85-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g92 X-ray 1.8 C 86-149  H-Bb S-Bb 


© NPIDB team 2003 - 2019

text