Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: C9X1G5
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 602-669
Organism: Neisseria meningitidis serogroup C
Interaction Mode:   

Sequence:
NKVLVLGSENQNKGNQTPYEYFNGKDNSREWQEFKARVETSRFPRSKKQRILLQKFDEDG
FKERNLND
Structures of the domain C9X1G5 602-669
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kc7 X-ray 3.3 A 714-787 None


© NPIDB team 2003 - 2021

text