Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: C9X1G5
RecName: CRISPR-associated endonuclease Cas9
Begin-End: 658-787
Organism: Neisseria meningitidis serogroup C
Interaction Mode:   

Sequence:
DEDGFKERNLNDTRYVNRFLCQFVADRMRLTGKGKKRVFASNGQITNLLRGFWGLRKVRA
ENDRHHALDAVVVACSTVAMQQKITRFVRYKEMNAFDGKTIDKETGEVLHQKTHFPQPWE
FFAQEVMIRV
Structures of the domain C9X1G5 658-787
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6je4 X-ray 3.07 K 658-785 None
6je4 X-ray 3.07 O 658-719 None
6je4 X-ray 3.07 A 658-785 None
6je4 X-ray 3.07 E 658-784 None
6jdv X-ray 3.1 A 654-787 None
6kc8 X-ray 2.9 A 653-787 None
6jdq X-ray 2.95 A 658-787 None
6je9 X-ray 3.46 C 658-777 None
6je9 X-ray 3.46 A 658-720 None


© NPIDB team 2003 - 2021

text