Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: D0VWU9
RecName: DNA polymerase
Begin-End: 20-131
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
KKENGEFKIEYDRTFEPYFYALLKDDSAIEEVKKITAERHGTVVTVKRVEKVQKKFLGRP
VEVWKLYFTHPQDVPAIRDKIREHPAVIDIYEYDIPFAKRYLIDKGLVPMEG
Structures of the domain D0VWU9 20-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vu8 X-ray 3.2 A 22-129 None
5vu7 X-ray 2.72 A 22-129 None
5vu6 X-ray 3 A 22-129 None
5vu9 X-ray 2.05 A 22-129 None


© NPIDB team 2003 - 2019

text