Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: D0VWU9
RecName: DNA polymerase
Begin-End: 344-748
Organism: Thermococcus kodakarensis
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
VSRSSTGNLVEWFLLRKAYERNELAPNKPDEKELARRRQSYEGGYVKEPERGLWENIVYL
DFRSLYPSIIITHNVSPDTLNREGCKEYDVAPQVGHRFCKDFPGFIPSLLGDLLEERQKI
KKKMKATIDPIERKLLDYRQRAIKILANSYYGYYGYARARWYCKECAESVTAWGREYITM
TIKEIEEKYGFKVIYSDTDGFFATIPGADAETVKKKAMEFLKYINAKLPGALELEYEGFY
ERGFFVTKKKYAVIDEEGKITTRGLEIVRRDWSEIAKETQARVLEALLKDGDVEKAVRIV
KEVTEKLSKYEVPPEKLVIHEQITRDLKDYKATGPHVAVAKRLAARGVKIRPGTVISYIV
LKGSGRIGDRAIPFDEFDPTKHKYDAEYYIENQVLPAVERILRAF
Structures of the domain D0VWU9 344-748
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vu8 X-ray 3.2 A 352-746 None
5vu7 X-ray 2.72 A 352-746  H-Bb S-Bb L-Bb L-Mn 
5vu6 X-ray 3 A 352-746  H-Bb S-Bb L-Bb L-Mn 
5vu9 X-ray 2.05 A 352-746  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text