Pfam domain
Pfam family: GFP (PF01353.21)
Uniprot AC: D1MPT3
RecName: PAmCherry1 protein
Begin-End: 11-222
Organism: Discosoma sp.
Interaction Mode:   

Sequence:
AIIKEFMRFKVHMEGSVNGHVFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFTWDILSPQF
MYGSNAYVKHPADIPDYFKLSFPEGFKWERVMKFEDGGVVTVTQDSSLQDGEFIYKVKLR
GTNFPSDGPVMQKKTMGWEALSERMYPEDGALKGEVKPRVKLKDGGHYDAEVKTTYKAKK
PVQLPGAYNVNRKLDITSHNEDYTIVEQYERA
Structures of the domain D1MPT3 11-222
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b0b X-ray 3.28 D 8-199 None
6b0b X-ray 3.28 H 8-199 None


© NPIDB team 2003 - 2019

text