Pfam domain
Pfam family: Put_DNA-bind_N (PF06971.12)
Uniprot AC: D5KM69
RecName: Redox-sensing transcriptional repressor Rex
Begin-End: 6-54
Organism: Thermoanaerobacter ethanolicus JW 200
Interaction Mode:  H-Mj 

Sequence:
IVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDLN
Structures of the domain D5KM69 6-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3wgi X-ray 3.25 C 7-54  H-Mj 
3wgi X-ray 3.25 D 7-54  H-Mj 
3wgi X-ray 3.25 B 7-54 None
3wgi X-ray 3.25 A 7-54 None


© NPIDB team 2003 - 2019

text