Pfam domain
Pfam family: Whirly (PF08536.10)
Uniprot AC: D9J034
RecName: Single-stranded DNA-binding protein WHY2, mitochondrial
Begin-End: 63-198
Organism: Solanum tuberosum
Interaction Mode:   

Sequence:
VFKGKAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVGERKYDWEKRQLFALSATE
VGSLISMGTRDSSEFFHDPSMLSSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDR
FTVPVTTAEFAVMRTA
Structures of the domain D9J034 63-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3n1l X-ray 2.35 A 63-197 None
3n1k X-ray 2.7 A 63-197 None
3n1j X-ray 2.65 A 63-197 None
3n1j X-ray 2.65 A 63-197 None
3n1i X-ray 2.2 A 63-197 None
3n1i X-ray 2.2 A 63-197 None
3ra0 X-ray 2.45 A 63-197 None
3ra0 X-ray 2.45 A 63-197 None


© NPIDB team 2003 - 2019

text