Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: D9N195
RecName: Melanoma differentiation associated protein-5
Begin-End: 674-800
Organism: Gallus gallus
Interaction Mode:   

Sequence:
EKLMKLRNTLMEEFTKTEEPRGIIFTKTRQSALALYHWIMDNPKFEEVGIKAHFLIGAGH
NSETKPMTQNEQREVIDKFRGGSINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQA
RGRARAD
Structures of the domain D9N195 674-800
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jch X-ray 2.95 A 683-798 None
5jch X-ray 2.95 B 683-798 None


© NPIDB team 2003 - 2019

text