Pfam domain
Pfam family: PadR (PF03551.13)
Uniprot AC: E0TW95
RecName: Transcriptional regulator
Begin-End: 8-82
Organism: Bacillus subtilis subsp. spizizenii
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
ILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRTTIQGTKLEK
KMYTLTDSGKQELHD
Structures of the domain E0TW95 8-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x11 X-ray 2.65 B 8-81  H-Bb H-Mj S-Bb L-Bb L-Mj 
5x11 X-ray 2.65 A 8-81  H-Bb H-Mj S-Bb L-Bb L-Mj 
5x11 X-ray 2.65 F 8-81  H-Bb H-Mj S-Bb L-Bb L-Mj 
5x11 X-ray 2.65 E 8-81  H-Bb H-Mj S-Bb L-Bb L-Mj 
5x11 X-ray 2.65 C 8-81 None
5x11 X-ray 2.65 D 8-81 None
5x11 X-ray 2.65 G 8-81 None
5x11 X-ray 2.65 H 8-81 None


© NPIDB team 2003 - 2019

text