Pfam domain
Pfam family: Vir_act_alpha_C (PF10400.8)
Uniprot AC: E0TW95
RecName: Transcriptional regulator
Begin-End: 94-179
Organism: Bacillus subtilis subsp. spizizenii
Interaction Mode:  L-Bb 

Sequence:
VKDEFMLKAYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMASAEPMSFSSPDFG
HYLVLTKALEREKNYVSWLESILAMI
Structures of the domain E0TW95 94-179
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x11 X-ray 2.65 A 94-178  L-Bb 
5x11 X-ray 2.65 B 94-179  L-Bb 
5x11 X-ray 2.65 E 94-178  L-Bb 
5x11 X-ray 2.65 F 94-179  L-Bb 
5x11 X-ray 2.65 C 94-179 None
5x11 X-ray 2.65 D 94-179 None
5x11 X-ray 2.65 G 94-177 None
5x11 X-ray 2.65 H 94-179 None


© NPIDB team 2003 - 2019

text