Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: E0YCK3
RecName: LAGLIDADG homing endonuclease I-LtrII
Begin-End: 15-117
Organism: Leptographium truncatum
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
ICGLVDAEGSFGVNVVKHATNKTGYAVLTYFELAMNSKDKQLLELIKKTFDLECNIYHNP
SDDTLKFKVSNIEQIVNKIIPFFEKYTLFSQKRGDFILFCKVV
Structures of the domain E0YCK3 15-117
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4lq0 X-ray 2.68 A 16-117  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text