Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: E0YCK3
RecName: LAGLIDADG homing endonuclease I-LtrII
Begin-End: 174-275
Organism: Leptographium truncatum
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFIEGEACFFVSIYNSPKSKLGKAVQLVFKITQHIRDKILIESIVELLNCGRVEVRKS
NEACDFTVTSIKEIENYIIPFFNEYPLIGQKLKNYEDFKLIF
Structures of the domain E0YCK3 174-275
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4lq0 X-ray 2.68 A 174-274  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text