Pfam domain
Pfam family: DNA_pol_A (PF00476.19)
Uniprot AC: E1C9K5
RecName: DNA polymerase I
Begin-End: 201-578
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
TKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYST
SADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFR
RDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFI
ERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPI
QGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYD
Structures of the domain E1C9K5 201-578
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xo7 X-ray 2.85 A 498-874 None
4dwi X-ray 1.85 A 498-874 None
2xy7 X-ray 3.05 A 498-874 None
2y1i X-ray 2.78 A 498-874 None
2y1j X-ray 2.15 A 498-874 None
2xy6 X-ray 2.3 A 498-874 None
2xy5 X-ray 2.22 A 498-874 None
4b9t X-ray 2.65 A 498-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dsk X-ray 2.18 A 498-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4b9m X-ray 2.05 A 498-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dsj X-ray 2.86 A 498-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
4dsj X-ray 2.86 B 498-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4dsl X-ray 2.45 A 498-874  H-Bb H-Mj H-Mn L-Bb L-Mn 
4dsi X-ray 2.05 A 498-874 None
4b9u X-ray 2.1 A 498-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4b9n X-ray 2.2 A 498-874 None
4b9v X-ray 2 A 498-874 None
4b9s X-ray 1.73 A 498-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4b9l X-ray 2.05 A 498-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4yfu X-ray 1.5 D 498-874 None
4yfu X-ray 1.5 A 498-874 None


© NPIDB team 2003 - 2019

text