Pfam domain
Pfam family: CRISPR_Cas2 (PF09827.8)
Uniprot AC: E6GPD6
RecName: CRISPR-associated endoribonuclease Cas2
Begin-End: 6-85
Organism: Enterococcus faecalis TX0027
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
MRLLLMFDMPTDTASDRKAYRKFRKFLINEGFIMHQFSVYSKILLNDTANKAMLARLKQN
NPQRGLITLLNVTEKQFSRM
Structures of the domain E6GPD6 6-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xvp X-ray 3 F 6-85  H-Bb H-Mj L-Mj 
5xvp X-ray 3 E 6-85  H-Bb H-Mj L-Bb L-Mj 
5xvn X-ray 3.25 E 6-85  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xvn X-ray 3.25 F 6-85  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xvn X-ray 3.25 M 6-85  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xvn X-ray 3.25 N 6-85  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xvo X-ray 3.1 E 6-85  H-Bb H-Mj L-Mj 
5xvo X-ray 3.1 F 6-85  L-Mj 
5xvo X-ray 3.1 M 6-85  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xvo X-ray 3.1 N 6-85  H-Bb H-Mj S-Bb L-Bb L-Mj 
5xvo X-ray 3.1 M 6-85  H-Mj L-Bb L-Mj 
5xvo X-ray 3.1 N 6-85  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5xvo X-ray 3.1 E 6-85  H-Bb H-Mj L-Mj 
5xvo X-ray 3.1 F 6-85  L-Mj 


© NPIDB team 2003 - 2019

text