Pfam domain
Pfam family: Cas_Cas1 (PF01867.15)
Uniprot AC: E6GPD7
RecName: CRISPR-associated endonuclease Cas1
Begin-End: 5-237
Organism: Enterococcus faecalis TX0027
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
TVVVNKHSKLSYKNNHLVFKAIDHQELIHLSEIDVLLLETTDISLTTMLLKRLIDEKILV
LFCDDKRLPIGKILPFYGRHDSSLQLTRQLAWTEERKGQVWTAIIAQKITNQSLHLAQRD
YGQKAAALLAMRAELRLFDPANREGHAARSYFNTLFGNDFTREQENDINAGLNYGYTLLL
SIFARELVQTGCFTQLGLKHANQFNDFNLASDLMEPFRPLVDQIIYENRKEAF
Structures of the domain E6GPD7 5-237
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xvp X-ray 3 C 7-230  H-Bb L-Bb L-Mj 
5xvp X-ray 3 D 7-230  L-Bb L-Mj 
5xvp X-ray 3 A 7-230  H-Bb L-Bb L-Mj 
5xvp X-ray 3 B 7-230  L-Mj L-Mn 
5xvn X-ray 3.25 C 7-230  L-Mj L-Mn 
5xvn X-ray 3.25 B 7-230  H-Bb S-Bb L-Bb 
5xvn X-ray 3.25 A 7-230  L-Mj 
5xvn X-ray 3.25 L 7-230  H-Bb S-Bb L-Bb 
5xvn X-ray 3.25 J 7-230  H-Bb S-Bb L-Bb 
5xvn X-ray 3.25 K 7-230  L-Mj 
5xvn X-ray 3.25 I 7-230  L-Mj 
5xvo X-ray 3.1 C 7-230 None
5xvo X-ray 3.1 D 7-230 None
5xvo X-ray 3.1 B 7-230  L-Mj 
5xvo X-ray 3.1 A 7-230  L-Bb L-Mj 
5xvo X-ray 3.1 I 7-230  L-Mj 
5xvo X-ray 3.1 L 7-230  H-Bb S-Bb L-Bb 
5xvo X-ray 3.1 J 7-230  H-Bb S-Bb L-Bb 
5xvo X-ray 3.1 K 7-230  L-Mj 
5xvo X-ray 3.1 C 7-230 None
5xvo X-ray 3.1 B 7-230  L-Mj 
5xvo X-ray 3.1 L 7-230  H-Bb 
5xvo X-ray 3.1 K 7-230  L-Mj 
5xvo X-ray 3.1 J 7-230  H-Bb 
5xvo X-ray 3.1 D 7-230 None
5xvo X-ray 3.1 I 7-230  L-Mj 
5xvo X-ray 3.1 A 7-230  L-Bb L-Mj 


© NPIDB team 2003 - 2019

text