Pfam domain
Pfam family: Filamin (PF00630.18)
Uniprot AC: E7FAM5
RecName: E3 ubiquitin-protein ligase TRIM71
Begin-End: 437-533
Organism: Danio rerio
Interaction Mode:   

Sequence:
GAFATASKAHGEGIKRALQGKPASFTVVGYDHDGEPRLSGGDSVSVVLMSPDGNLSSAEV
SDHQDGTYTVSYLPKGEGEHLLSVLICNQHIEGSPFK
Structures of the domain E7FAM5 437-533
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fql X-ray 2.35 A 440-533 None
6fq3 X-ray 1.9 A 440-533 None


© NPIDB team 2003 - 2019

text