Pfam domain
Pfam family: Ribosomal_S7e (PF01251.17)
Uniprot AC: E9B7A8
RecName: 40S ribosomal protein S7
Begin-End: 7-190
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
KLRKLKRGKPSDLEESVAKALFELETSHKTLRQELPRFHVNTVREVKVPRSKKTVLVVFY
PLRFLMLVRKVQRALTSELEKRHPGYLVMLVAQRKITKRPTDVYKLQKVQRSKTSTAVFE
NILNDMIYPSDVVGRRWRCRTDGSKLMKVFLDARDRKRVESRLRAVAYVYKQLTHRRVSF
GFMW
Structures of the domain E9B7A8 7-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 I 8-189 None


© NPIDB team 2003 - 2019

text