Pfam domain
Pfam family: Ribosomal_S21e (PF01249.17)
Uniprot AC: E9BAR6
RecName: 40S ribosomal protein S21, putative (Fragment)
Begin-End: 127-202
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
MFNEEGENVDLYIPRKCHATNTLIEAHDHAAVQISIANVGPNGVINGTTTTLCIAGYLRS
QGESDHAINHITIDRG
Structures of the domain E9BAR6 127-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 Y 6-83 None


© NPIDB team 2003 - 2019

text