Pfam domain
Pfam family: Ribosomal_S8 (PF00410.18)
Uniprot AC: E9BAV6
RecName: 40S ribosomal protein S15A, putative
Begin-End: 5-130
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
SVLANALRTIASAERRGKRQVLIRPSSKVVVKFLQVMQKHGYIGEFEIIDDHRAGKIVVN
LNGRLNKCGAICPRFDCATTDYEKWMKNILPSRQFGFVVLTTSLGIMDHEEARSRNTGGK
VLGFFY
Structures of the domain E9BAV6 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 J 7-130 None


© NPIDB team 2003 - 2019

text