Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: E9BBC0
RecName: 40S ribosomal protein S12
Begin-End: 28-123
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
DAVRIVIQKALEANGLVRGLSEVARTLDCKTAHMCILADDCEDEEYKKLVTALAKQGNID
LINVEEREKLAQWAGLVRRDVAGEVTKTLKCSSVAI
Structures of the domain E9BBC0 28-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 Q 29-121 None


© NPIDB team 2003 - 2019

text