Pfam domain
Pfam family: RS4NT (PF08071.11)
Uniprot AC: E9BBI6
RecName: 40S ribosomal protein S4
Begin-End: 2-36
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
AKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLR
Structures of the domain E9BBI6 2-36
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 E 3-36 None


© NPIDB team 2003 - 2019

text