Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: E9BBI6
RecName: 40S ribosomal protein S4
Begin-End: 39-87
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
LPLLVIIRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYPAGFMDVV
Structures of the domain E9BBI6 39-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 E 40-87 None


© NPIDB team 2003 - 2019

text