Pfam domain
Pfam family: Ribosomal_S4e (PF00900.19)
Uniprot AC: E9BBI6
RecName: 40S ribosomal protein S4
Begin-End: 92-166
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
TGDRFRLMYDVKGRFALVSLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHT
SIGDTIVYNVKEKKC
Structures of the domain E9BBI6 92-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 E 92-165 None


© NPIDB team 2003 - 2019

text