Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: E9BFB6
RecName: 40S ribosomal protein S23, putative
Begin-End: 29-142
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
RAHTFSARKANPFGGSSHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPND
GCLHFIEENDEVLVSGFGRSGHAVGDIPGVRFKIVKVSNVGLYALYRQKKEKPR
Structures of the domain E9BFB6 29-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 P 31-142 None


© NPIDB team 2003 - 2019

text