Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: E9BFQ0
RecName: 40S ribosomal protein S15, putative
Begin-End: 1-84
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
MNRHVDRRPPVLLKRLREAKKHVKVGEKPKAVKTHLRDVVITPEMVGSVVAIYNGHQFNA
VEIKGEMIGHYLGEFSMSYRPVLH
Structures of the domain E9BFQ0 1-84
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 W 51-135 None


© NPIDB team 2003 - 2019

text