Pfam domain
Pfam family: Ribosomal_S8e (PF01201.21)
Uniprot AC: E9BH78
RecName: 40S ribosomal protein S8
Begin-End: 2-203
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
GIVRSRLHKRKITGGKTKIHRKRMKAELGRLPANTRLGARRVSPVRARGGNFKIRALRLD
TGNFAWASEAIAHRVRLLDVVYNATSNELVRTKTLVKNCIVAVDAAPFKRWYAKHYGIDL
DADRKTTKAAAAAEKKGRKSVHAAADKYDVNKASPKLQREWIRRRRNHRVEKAIADQLRE
GRVLARITSRPGQSGRADGILL
Structures of the domain E9BH78 2-203
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 K 3-203 None


© NPIDB team 2003 - 2019

text