Pfam domain
Pfam family: Ribosomal_S25 (PF03297.14)
Uniprot AC: E9BHM6
RecName: Ribosomal protein S25
Begin-End: 35-104
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
ALQNAVMFDKETYDKLRSEVPKYKLITPSIISDRLKIAVSIAAAGLKQLCREKLIRLVSC
SSKTRVYTRI
Structures of the domain E9BHM6 35-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 a 23-90 None


© NPIDB team 2003 - 2019

text