Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: E9BI96
RecName: 40S ribosomal protein S16, putative
Begin-End: 16-149
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
GKKKTAIAVATVTKAAQCNIKVNGVPLQQILPDTLRAKIMEAITVVGSKYYSRLRIDVAV
HGGGQVSQAYAARQAIAKGLIAFFQKYHNEVEKAALKDKFLAYDKFLLIADPRRCEPKKW
GRHSARTRFTKSYR
Structures of the domain E9BI96 16-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 L 16-149 None


© NPIDB team 2003 - 2019

text