Pfam domain
Pfam family: Ribosomal_S28e (PF01200.17)
Uniprot AC: E9BIH3
RecName: 40S ribosomal protein S33, putative
Begin-End: 22-86
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
AQVGLIIKVLGRTGSRGNVTQVRVRLMAEAGSPDYNRTIVRNVKGPCKENDMLSLMETER
EARRL
Structures of the domain E9BIH3 22-86
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 d 2-65 None


© NPIDB team 2003 - 2019

text