Pfam domain
Pfam family: Ribosomal_S10 (PF00338.21)
Uniprot AC: E9BJI2
RecName: Ribosomal protein S20, putative
Begin-End: 18-112
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
RLTITSRNAKAVESVTSQLLTRARDEKVTIHGPVRLPTRTLKITTRKTPCGNGTNTWDTF
ELKIYKRIIDLHAPTEQVKKITSFTMESGVDVSIT
Structures of the domain E9BJI2 18-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 M 18-112 None


© NPIDB team 2003 - 2019

text