Pfam domain
Pfam family: Ribosomal_S14 (PF00253.20)
Uniprot AC: E9BJV7
RecName: Ribosomal protein S29, putative
Begin-End: 6-57
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
QWRSRQKIGMGKGARCCVICSNQKALIRKYELNVCRQCFRENAEHIGFTKLR
Structures of the domain E9BJV7 6-57
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 S 15-55 None


© NPIDB team 2003 - 2019

text