Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: E9BJZ5
RecName: 40S ribosomal protein S17, putative
Begin-End: 2-123
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
GKIRTKTVKRASRQVVEKYYSKLNFDFYQNKRVIMDVTIAESKKLKNKIAGYTTHIMKRL
ARGPVRGISLKLQEEERERRMDHAPATSDVDKAIQSGVSVDKRTMQMLQRLEIGVPRRVK
RA
Structures of the domain E9BJZ5 2-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 V 2-119 None


© NPIDB team 2003 - 2019

text