Pfam domain
Pfam family: Ribosomal_S26e (PF01283.18)
Uniprot AC: E9BK95
RecName: 40S ribosomal protein S26
Begin-End: 2-104
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
TTKRRNHGRSKPAHSRGRVKPIHCFNCGRLTPKDKAVGRFVVRRMLDAASARDVAEASPV
YGANFPMPKLYMKQRFCIACAIHSRTVRARPVGNRKIRYTRKV
Structures of the domain E9BK95 2-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 b 1-100 None


© NPIDB team 2003 - 2019

text