Pfam domain
Pfam family: Ribosomal_S30 (PF04758.13)
Uniprot AC: E9BLG3
RecName: 40S ribosomal protein S30
Begin-End: 3-60
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
KIHGSLARAGKVKNQTPKVAKQEKPKQPRGRALKRLKYTRRFLSKTVKPGEKVHMNKQ
Structures of the domain E9BLG3 3-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 e 3-59 None


© NPIDB team 2003 - 2019

text