Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: E9BMA8
RecName: 40S ribosomal protein S14
Begin-End: 22-140
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
GVVHIYASFNDTFVHVTDTSGRETYVKVTGGMKVKADRDESSPYAAMMAAQDVVARCKEC
GINALHVKMRAVGGVRTKSPGPGAQAALRALARAGMKIGRIEDVTPIPTDSTRRKGSRR
Structures of the domain E9BMA8 22-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 O 22-140 None


© NPIDB team 2003 - 2019

text