Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: E9BNF0
RecName: 40S ribosomal protein S2
Begin-End: 87-151
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
LHDEMMKIYPVQKATSAGQRTRFKAFNVVGDCDGHIGIGARVGKEVSLAIRASMIAAKLN
IVPVR
Structures of the domain E9BNF0 87-151
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 F 88-152 None


© NPIDB team 2003 - 2019

text