Pfam domain
Pfam family: Ribosomal_S13_N (PF08069.11)
Uniprot AC: E9BPR7
RecName: 40S ribosomal protein S13, putative
Begin-End: 2-60
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
VRMHGNGRGKASSALPYRRTPPAWLKIASRNVVKMVCKSSRKGMMPSQIGMELRDSMGI
Structures of the domain E9BPR7 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 T 3-60 None


© NPIDB team 2003 - 2019

text