Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: E9BPR7
RecName: 40S ribosomal protein S13, putative
Begin-End: 70-143
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
KILRILKHSGLAPEIPEDLYFLVKRATQMRKHLERHTTDRDTKYRLILVESRIHRLARYY
KRVKQLPPTWKYES
Structures of the domain E9BPR7 70-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 T 75-141 None


© NPIDB team 2003 - 2019

text