Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: E9BQ25
RecName: 40S ribosomal protein S3, putative
Begin-End: 142-218
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
ELFEFLKRELAEEGFSGVSYHVTTLRTEIVIKATKTREVLGVNGRRIRELTACIQQRFNY
KEGKLQLYVERVEVRGL
Structures of the domain E9BQ25 142-218
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 C 21-91 None


© NPIDB team 2003 - 2019

text