Pfam domain
Pfam family: Ribosomal_S19e (PF01090.18)
Uniprot AC: E9BR60
RecName: 40S ribosomal protein S19 protein, putative
Begin-End: 37-173
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
SLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCAAVLRAI
YLRPGVGYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPGAQSGQRLT
RKGHKFADSLAFQVQIR
Structures of the domain E9BR60 37-173
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 X 38-170 None


© NPIDB team 2003 - 2019

text