Pfam domain
Pfam family: Ribosomal_S3Ae (PF01015.17)
Uniprot AC: E9BRS2
RecName: 40S ribosomal protein S3a
Begin-End: 23-224
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
ETMARKEWYDVVAPANFEKRQFAKTICNKTQGTRIAADVLRGRVFEANLADLNQSAGEEE
AYRKVRFTVQEVQGRNLLTQFHSMEVTTDKMASLLRKWCTTMETTVEVKTADGYTMRLFV
VAFTKPQANQQSRNCYAKQRLVKWLRMRITKMIKRRLSKVQIKEAVSLLTRNVLSDALVR
RCNPILPLRELRIRKVRVVRTP
Structures of the domain E9BRS2 23-224
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 A 23-223 None


© NPIDB team 2003 - 2019

text