Pfam domain
Pfam family: Ribosomal_S27 (PF01599.18)
Uniprot AC: E9BTC5
RecName: Ubiquitin/ribosomal protein S27a, putative
Begin-End: 97-146
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
ALKYFKVTENDDGSYKVERTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLT
Structures of the domain E9BTC5 97-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 f 59-100 None


© NPIDB team 2003 - 2019

text