Pfam domain
Pfam family: Ribosomal_S13 (PF00416.21)
Uniprot AC: E9BTF9
RecName: 40S ribosomal protein S18, putative
Begin-End: 28-156
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
RLLNTNVEGKRKVPFALRMVKGVGIRFAYLVCKKAGIDVERRAGTLTAEELEKIAEIIAD
PAKFKIPDWFLNRQRDPKTGKTEHLSSSMVDTRLREDLERLKKIRAHRGVRHAYGLRVRG
QHTCTTGRH
Structures of the domain E9BTF9 28-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 R 15-142 None


© NPIDB team 2003 - 2019

text