Pfam domain
Pfam family: S10_plectin (PF03501.14)
Uniprot AC: E9BTG4
RecName: 40S ribosomal protein S10, putative (Fragment)
Begin-End: 36-122
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
VPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTVPCIQVMQLMRSLKSRNLIKE
QYAWRHYYWTLNDEGIAYMRSYLHLAP
Structures of the domain E9BTG4 36-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 N 36-121 None


© NPIDB team 2003 - 2019

text