Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: E9BTJ0
RecName: 40S ribosomal protein S9, putative
Begin-End: 5-129
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
NNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVNMTLSKMRRTARLLLTLPEN
HPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPDILERRLQTIVFKAGLAKSVHHA
RVLIQ
Structures of the domain E9BTJ0 5-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 D 16-61 None


© NPIDB team 2003 - 2019

text